Product Overview
Description
CLPP-00150517 is recombinant human CCNT1 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
Sequence Similarities
Belongs to the cyclin family. Cyclin C subfamily.
Predicted Molecular Weight
37 kDa including tags
Target Information
Alternative Names
CCN T1; CCNT; CCNT 1; Ccnt1; CCNT1_HUMAN; CDK9 associated C type protein; Cyc T1; Cyclin C related protein; Cyclin T; cyclin T1; Cyclin T1b; Cyclin-T; Cyclin-T1; CYCT 1; CycT1; HIVE1; Human immunodeficiency virus 1 expression; Human immunodeficiency virus type 1 (HIV 1) expression (elevated) 1; pTEFb subunit; Subunit of positive elongation transcription factor b
Protein Function
Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which facilitates the transition from abortive to productive elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). Required to activate the protein kinase activity of CDK9: acts by mediating formation of liquid-liquid phase separation (LLPS) that enhances binding of P-TEFb to the CTD of RNA Pol II; (Microbial infection) In case of HIV or SIV infections, binds to the transactivation domain of the viral nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA). Serves as an essential cofactor for Tat, by promoting RNA Pol II activation, allowing transcription of viral genes.
Tissue Specificity
Ubiquitously expressed.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
