Product Overview
Description
CLPP-00150513 is recombinant human CCNH protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Sequence Similarities
Belongs to the cyclin family. Cyclin C subfamily.
Target Information
Alternative Names
6330408H09Rik; AI661354; AV102684; AW538719; CAK; CAK complex subunit; ccnh; CCNH_HUMAN; CDK activating kinase; CDK activating kinase complex subunit; Cyclin dependent kinase activating kinase; cyclin dependent kinase activating kinase complex subunit; Cyclin H; Cyclin-H; CyclinH; MO15 associated protein; MO15-associated protein; p34; p36; p37
Protein Function
Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
Shipping & Handling
Constituents
0.0308% DTT, 0.316% Tris HCl, 0.0584% EDTA, 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
