Product Overview
Description
CLPP-00150482 is recombinant human GADD45GIP1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Predicted Molecular Weight
23 kDa including tags
Target Information
Alternative Names
39S ribosomal protein L59 mitochondrial; CKBBP2; CKbetaBP2; CKII beta associating protein; CKII beta binding protein 2; CKII beta-associating protein; CR6 interacting factor 1; CR6-interacting factor 1; CRIF1; G45IP_HUMAN; GADD45G interacting protein 1; Gadd45gip1; Growth arrest and DNA damage inducible GADD45G interacting protein; growth arrest and DNA damage inducible, gamma interacting protein 1; Growth arrest and DNA damage-inducible proteins-interacting protein 1; MGC4667; MGC4758; MRP L59; p53 responsive gene 6; p53 responsive gene 6 protein; p53-responsive gene 6 protein; Papillomavirus L2 interacting nuclear protein 1; Papillomavirus L2-interacting nuclear protein 1; PLINP; PLINP 1; PLINP-1; PLINP1; PRG6
Protein Function
Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity. May play a role in mitochondrial protein synthesis.
Tissue Specificity
Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary thyroid cancer.
Shipping & Handling
Constituents
0.03% DTT, 0.32% Tris HCl, 40% Glycerol (glycerin, glycerine), 1.17% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
