Product Overview
Description
CLPP-00150478 is recombinant human CORO1A protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Sequence Similarities
Belongs to the WD repeat coronin family. Contains 7 WD repeats.
Target Information
Alternative Names
Actin binding protein; CLABP; Clipin A; Clipin-A; CLIPINA; COR1A_HUMAN; CORO1A; Coronin 1; Coronin actin binding protein 1A; Coronin like protein A; Coronin like protein p57; Coronin-1A; Coronin-like protein A; Coronin-like protein p57; FLJ41407; HCORO1; MGC117380; OTTHUMP00000163017; p57; TACO; Tryptophan aspartate containing coat protein; Tryptophan aspartate-containing coat protein
Protein Function
May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.
Tissue Specificity
Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
Involvement in Disease
Immunodeficiency 8 (IMD8): A disease of the immune system leading to recurrent infections, and characterized by CD4+ T-cells lymphopenia. Patients can develop B-cell lymphoproliferation associated with Epstein-Barr virus infection. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
