Product Overview
Description
CLPP-00150473 is recombinant human CFL2 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Sequence Similarities
Belongs to the actin-binding proteins ADF family. Contains 1 ADF-H domain.
Predicted Molecular Weight
21 kDa including tags
Target Information
Alternative Names
CFL 2; CFL2; COF2_HUMAN; Cofilin; Cofilin 2 muscle; Cofilin muscle; Cofilin muscle isoform; Cofilin-2; Cofilin2; muscle isoform; NEM 7; NEM7
Protein Function
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
Tissue Specificity
Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Involvement in Disease
Defects in CFL2 are the cause of nemaline myopathy type 7 (NEM7). A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Nemaline myopathy type 7 presents at birth with hypotonia and generalized weakness. Major motor milestones are delayed, but independent ambulation is achieved.
Shipping & Handling
Constituents
0.04% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.29% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
