Product Overview
Description
CLPP-00150466 is recombinant human CIT protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
FEVRSLVGCGHFAEVQVVREKATGDIYAMKVMKKKALLAQEQVSFFEEERNILSRSTSPWIPQLQYAFQDKNHLYLVMEYQPGGDLLSLLNRYEDQLDENLIQFYLAELILAVHSVHLMGYVHRDIKPENILVDRTGHIKLVDFGSAAKMNSNKMVNAKLPIGTPDYMAPEVLTVMNGDGKGTYGLDCDWWSVGVIAYEMIYGRSPFAEGTSARTFNNIMNFQRFLKFPDDPKVSSDFLDLIQSLLCGQKERLKFEGLCCHPFF
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 CNH domain. Contains 1 PH domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 protein kinase domain.
Predicted Molecular Weight
231 kDa
Target Information
Alternative Names
CIT; Citron; Citron (rho interacting serine/threonine kinase 21); Citron Rho interacting kinase; Citron Rho-interacting kinase; CRIK; CTRO_HUMAN; EC 2.7.11.1; KIAA0949; Rho interacting serine/threonine kinase 21; Rho interacting serine/threonine protein kinase 21; Serine/threonine-protein kinase 21; STK2; STK21
Protein Function
Plays a role in cytokinesis. Required for KIF14 localization to the central spindle and midbody. Putative RHO/RAC effector that binds to the GTP-bound forms of RHO and RAC1. It probably binds p21 with a tighter specificity in vivo. Displays serine/threonine protein kinase activity. Plays an important role in the regulation of cytokinesis and the development of the central nervous system. Phosphorylates MYL9/MLC2.
Involvement in Disease
Microcephaly 17, primary, autosomal recessive (MCPH17): A form of microcephaly, a disease defined as a head circumference more than 3 standard deviations below the age, sex and ethnically matched mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. MCPH17 is a severe form characterized by lissencephaly, enlarged ventricles, agenesis of the corpus callosum, cerebellar hypoplasia, and brainstem hypoplasia. Patients manifest delayed psychomotor development, intellectual disability, spasticity, axial hypotonia, and dysmorphic features. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
6% Trehalose, 0.24% Tris, 2.9% Sodium chloride, 0.12% Hydrochloric acid.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
