Product Overview
Description
CLPP-00150455 is recombinant human CERT1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Sequence Similarities
Contains 1 PH domain. Contains 1 START domain.
Predicted Molecular Weight
33 kDa including tags
Target Information
Alternative Names
Alpha 3 type IV collagen binding protein; C43BP_HUMAN; Ceramide transfer protein; Ceramide transporter; CERT; Cert protein; CERTL; col4a3bp; Collagen type IV alpha 3 (Goodpasture antigen) binding protein; Collagen type IV alpha 3 binding protein; Collagen type IV alpha-3-binding protein; FLJ20597; Goodpasture antigen binding protein; Goodpasture antigen-binding protein; GPBP; hCERT; Lipid transfer protein CERTL; Procollagen type IV alpha 3 (Goodpasture antigen) binding protein; StAR related lipid transfer (START) domain containing 11; StAR related lipid transfer protein 11; StAR-related lipid transfer protein 11; StARD 11; StARD11; START domain containing 11; START domain containing protein 11; START domain-containing protein 11
Protein Function
Shelters ceramides and diacylglycerol lipids inside its START domain and mediates the intracellular trafficking of ceramides and diacylglycerol lipids in a non-vesicular manner.
Tissue Specificity
Widely expressed.
Involvement in Disease
Intellectual developmental disorder, autosomal dominant 34 (MRD34): A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
