Product Overview
Description
CLPP-00150436 is recombinant human CDKN3 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Sequence Similarities
Belongs to the protein-tyrosine phosphatase family.
Predicted Molecular Weight
26 kDa including tags
Target Information
Alternative Names
CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991
Protein Function
Serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle; involved in G0-G1 and G1-S cell cycle transitions. Interacts with CCNC/cyclin-C during interphase. Phosphorylates histone H1, ATF1, RB1 and CABLES1. ATF1 phosphorylation triggers ATF1 transactivation and transcriptional activities, and promotes cell proliferation and transformation. CDK3/cyclin-C mediated RB1 phosphorylation is required for G0-G1 transition. Promotes G1-S transition probably by contributing to the activation of E2F1, E2F2 and E2F3 in a RB1-independent manner.
Involvement in Disease
Defects in CDKN3 are found in patients with hepatocellular carcinoma (HCC).
Shipping & Handling
Constituents
0.0154% DTT, 0.316% Tris HCl, 40% Glycerol (glycerin, glycerine), 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
