Product Overview
Description
CLPP-00150416 is recombinant human CDK5RAP3 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLR
ILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQ
FYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVV
ERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDA
LTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYV
DRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Predicted Molecular Weight
59 kDa including tags
Sequence Similarities
Belongs to the CDK5RAP3 family.
Target Information
Alternative Names
C53; CDK5 activator binding protein C53; CDK5 activator-binding protein C53; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; Cdk5rap3; CK5P3_HUMAN; HSF 27; HSF27; IC53; Ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; PP1553; Protein HSF-27
Protein Function
Substrate adapter for ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to substrate proteins, in response to endoplasmic reticulum stress. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1. Required for liver development (By similarity); (Microbial infection) May be negatively regulated by hepatitis B virus large envelope protein mutant pre-s2 to promote mitotic entry.
Tissue Specificity
Ubiquitous. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform 3 is expressed in kidney, liver, skeletal muscle and placenta.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
79% PBS, 20% Glycerol (glycerin, glycerine), 0.02% DTT.