Product Overview
Description
CLPP-00150381 is recombinant human CDC42 protein, mutated G12V
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily.
Target Information
Alternative Names
CDC42; CDC42_HUMAN; CDC42Hs; Cell division control protein 42 homolog; Cell division cycle 42; Cell division cycle 42 (GTP binding protein 25kDa); dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)); G25K; G25K GTP-binding protein; Growth regulating protein; GTP binding protein 25kDa; Small GTP binding protein CDC42; TKS
Protein Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Regulates cell migration. In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections. Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. In podocytes, facilitates filopodia and podosomes formation upon DOCK11-activation. Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling (By similarity). Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups.
Involvement in Disease
Takenouchi-Kosaki syndrome (TKS): An autosomal dominant syndrome characterized by macrothrombocytopenia, lymphedema, intellectual disability, developmental delay, and distinctive facial features. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.58% Sodium chloride, 0.79% Tris HCl, 0.039% Beta mercaptoethanol, 0.0475% Magnesium chloride.
Shipping
Shipped on dry ice.
