Product Overview
Description
CLPP-00151192 is recombinant human CD320 protein
Applications
HPLC, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Predicted Molecular Weight
47 kDa including tags
Sequence Similarities
Contains 2 LDL-receptor class A domains.
Endotoxin Level
< 1.000 Eu/µg
Target Information
Alternative Names
8D6; 8D6 antigen; 8D6A; CD320; CD320 antigen; CD320_HUMAN; FDC-signaling molecule 8D6; FDC-SM-8D6; TCblR; Transcobalamin receptor
Protein Function
Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10.
Involvement in Disease
Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC); also called methylmalonic aciduria due to transcobalamin receptor defect. MMATC is a metabolic disorder characterized by increased blood C3-acylcarnitine levels, elevated methylmalonate and homocysteine, and low uptake of transcobalamin-bound cobalamin, but normal conversion to adenosylcobalamin and methylcobalamin. Plasma vitamin B12 and total homocysteine are normal.
Tissue Specificity
Expressed abundantly on follicular dendritic cells (FDCs).
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
Constituents
0.24% Tris, 0.88% Sodium chloride.