Product Overview
Description
CLPP-00150359 is recombinant human CAMK2B protein, Active
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALESSDSAN
TTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFH
RFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVW
HRRDGKWQNVHFHCSGAPVAPLQ
Sequence Similarities
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. Contains 1 protein kinase domain.
Target Information
Alternative Names
Calcium/calmodulin dependent protein kinase (CaM kinase) II beta; Calcium/calmodulin dependent protein kinase II beta; Calcium/calmodulin dependent protein kinase IIB; Calcium/calmodulin dependent protein kinase type II beta chain; calcium/calmodulin-dependent protein kinase II beta; Calcium/calmodulin-dependent protein kinase type II subunit beta; CAM 2; CaM kinase II beta chain; CaM kinase II beta subunit; CaM kinase II subunit beta; CaM-kinase II beta chain; CAM2; CAMK 2; CAMK 2B; CaMK II beta subunit; CaMK II subunit beta; CaMK-II subunit beta; CAMK2; CaMK2 beta; Camk2b; CAMKB; CaMKII beta subunit; CaMKIIB; KCC2B_HUMAN; MGC29528; Proline rich calmodulin dependent protein kinase; proline rich calmodulin-dependent protein kinase
Protein Function
Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in dendritic spine and synapse formation, neuronal plasticity and regulation of sarcoplasmic reticulum Ca(2+) transport in skeletal muscle. In neurons, plays an essential structural role in the reorganization of the actin cytoskeleton during plasticity by binding and bundling actin filaments in a kinase-independent manner. This structural function is required for correct targeting of CaMK2A, which acts downstream of NMDAR to promote dendritic spine and synapse formation and maintain synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning. In developing hippocampal neurons, promotes arborization of the dendritic tree and in mature neurons, promotes dendritic remodeling. Also regulates the migration of developing neurons. Participates in the modulation of skeletal muscle function in response to exercise. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca(2+) transport and in fast-twitch muscle participates in the control of Ca(2+) release from the SR through phosphorylation of triadin, a ryanodine receptor-coupling factor, and phospholamban (PLN/PLB), an endogenous inhibitor of SERCA2A/ATP2A2. In response to interferon-gamma (IFN-gamma) stimulation, catalyzes phosphorylation of STAT1, stimulating the JAK-STAT signaling pathway (By similarity). Phosphorylates reticulophagy regulator RETREG1 at 'Ser-151' under endoplasmic reticulum stress conditions which enhances RETREG1 oligomerization and its membrane scission and reticulophagy activity.
Tissue Specificity
Widely expressed. Expressed in adult and fetal brain. Expression is slightly lower in fetal brain.
Involvement in Disease
Intellectual developmental disorder, autosomal dominant 54 (MRD54): A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol.
Shipping
Shipped on Dry Ice.
