Product Overview
Description
CLPP-00150334 is recombinant human BRAF protein, mutated G466Y
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSYSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Sequence Similarities
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 protein kinase domain. Contains 1 RBD (Ras-binding) domain.
Predicted Molecular Weight
69 kDa including tags
Target Information
Alternative Names
FLJ95109; 94 kDa B raf protein; B raf; B raf 1; B Raf proto oncogene serine threonine protein kinase; B Raf proto oncogene, serine/threonine kinase; B RAF1; B-Raf proto-oncogene serine/threonine-protein kinase (p94); BRAF; BRAF 1; BRAF_HUMAN; BRAF1; cRmil; MGC126806; MGC138284; Murine sarcoma viral (v-raf) oncogene homolog B1; Murine sarcoma viral v raf oncogene homolog B1; NS7; Oncogen BRAF; oncogene BRAF1; p94; Proto-oncogene B-Raf; Proto-oncogene c-Rmil; Raf; RAFB 1; RAFB1; RMIL; Serine/threonine-protein kinase B-raf; v raf murine sarcoma viral oncogene homolog B; v raf murine sarcoma viral oncogene homolog B1; v-Raf murine sarcoma viral oncogene homolog B1
Protein Function
Protein kinase involved in the transduction of mitogenic signals from the cell membrane to the nucleus (Probable). Phosphorylates MAP2K1, and thereby activates the MAP kinase signal transduction pathway. May play a role in the postsynaptic responses of hippocampal neurons.
Tissue Specificity
Brain and testis.
Involvement in Disease
Defects in BRAF are found in a wide range of cancers.Defects in BRAF may be a cause of colorectal cancer (CRC), lung cancer (LNCR), non-Hodgkin lymphoma (NHL), cardiofaciocutaneous syndrome (CFC syndrome), Noonan syndrome type 7 (NS7), LEOPARD syndrome type 3 (LEOPARD3).
Shipping & Handling
Constituents
0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine).
Shipping
Shipped on Dry Ice.