Product Overview
Description
CLPP-00150325 is recombinant human BMP7 protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCHLEHHHHHH
Sequence Similarities
Belongs to the TGF-beta family.
Target Information
Alternative Names
BMP 7; BMP-7; Bmp7; BMP7_HUMAN; Bone morphogenetic protein 7; Bone morphogenic protein 7; Eptotermin alfa; OP 1; OP-1; OP1; Osteogenic protein 1
Protein Function
Growth factor of the TGF-beta superfamily that plays important role in various biological processes, including embryogenesis, hematopoiesis, neurogenesis and skeletal morphogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2A. Once all three components are bound together in a complex at the cell surface, ACVR2A phosphorylates and activates ACVR1. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. For specific functions such as growth cone collapse in developing spinal neurons and chemotaxis of monocytes, uses also BMPR2 as type II receptor. Can also signal through non-canonical pathways such as P38 MAP kinase signaling cascade that promotes brown adipocyte differentiation through activation of target genes, including members of the SOX family of transcription factors.
Tissue Specificity
Expressed in the kidney and bladder. Lower levels seen in the brain.
Shipping & Handling
Constituents
0.294% Sodium citrate, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.