Product Overview
Description
CLPP-00150320 is recombinant human BMI1 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGSSATSSG
Sequence Similarities
Contains 1 RING-type zinc finger.
Predicted Molecular Weight
62 kDa including tags
Target Information
Alternative Names
B lymphoma Mo MLV insertion region (mouse); B lymphoma Mo MLV insertion region 1 homolog; Bmi 1; BMI1; BMI1 polycomb ring finger oncogene; BMI1_HUMAN; Flvi 2/bmi 1; FLVI2/BMI1; MGC12685; Murine leukemia viral (bmi 1) oncogene homolog; Oncogene BMI 1; PCGF 4; PCGF4; Polycomb complex protein BMI 1; Polycomb complex protein BMI-1; Polycomb group protein Bmi1; Polycomb group ring finger 4; Polycomb group RING finger protein 4; RING finger protein 51; RNF 51; RNF51
Protein Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A. In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Shipping & Handling
Constituents
0.3% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
