Product Overview
Description
CLPP-00150086 is a recombinant human BLOC1S2 protein produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).
Nature
Recombinant Protein
Sequence
MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Predicted Molecular Weight
11.3 kDa
Endotoxin Level
Not Tested
Target Information
Alternative Names
BLOC1S2; Centrosome protein oncogene; Centrosome-associated protein; CEAP; RP11-316M21.4; BLOC-1 subunit 2; BLOS2; Centrosomal 10 kDa protein
Protein Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (By similarity). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. May play a role in cell proliferation.
Shipping & Handling
Shipping
Shipped on dry ice.
Storage
Store at -80 °C for up to 1 year.
Constituents
Supplied in 25 mM Tris. HCl, pH 7.3, 100 mM glycine, 10% glycerol.