Product Overview
Description
BLOC1S2 (Biogenesis of lysosome-related organelles complex 1 subunit 2) belongs to the BLOC1S2 family. BLOC-1 or biogenesis of lysosome-related organelles complex 1 is a ubiquitously expressed multisubunit protein complex. BLOC-1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules. This protein plays a role in cell proliferation. recombinant human BLOC1S2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Predicted Molecular Weight
18.5 kDa
Target Information
Alternative Names
biogenesis of lysosomal organelles complex-1, subunit 2; BLOC-1 subunit 2; CEAP; centrosomal 10 kDa protein; centrosome protein oncogene; Centrosome-associated protein; subunit 2
Protein Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (By similarity). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. May play a role in cell proliferation.
Shipping & Handling
Constituents
20 mM Tris-HCl buffer (pH8.0), 10% glycerol, 1 mM DTT, 50 mM NaCl.
Shipping
Shipped on dry ice.
Storage
Store at -20 °C for long term.
