Product Overview
Description
CLPP-00150316 is recombinant human BIN2 protein
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSN
Sequence Similarities
Contains 1 BAR domain.
Predicted Molecular Weight
30 kDa including tags
Target Information
Alternative Names
BIN2; BIN2_HUMAN; BRAP 1; Breast cancer associated protein BRAP1; Breast cancer-associated protein 1; Bridging integrator 2
Protein Function
Promotes cell motility and migration, probably via its interaction with the cell membrane and with podosome proteins that mediate interaction with the cytoskeleton. Modulates membrane curvature and mediates membrane tubulation. Plays a role in podosome formation. Inhibits phagocytosis.
Tissue Specificity
Highest level expression seen in spleen and peripheral blood leukocytes and is also expressed at high levels in thymus, colon and placenta, suggesting preferential expression in hematopoietic tissues.
Shipping & Handling
Constituents
99% Phosphate Buffer, 0.88% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C for long term.
