Product Overview
Description
CLPP-00150313 is recombinant human TUBB protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
Sequence Similarities
Belongs to the tubulin family.
Predicted Molecular Weight
76 kDa including tags
Target Information
Alternative Names
Beta 4 tubulin; Beta 5 tubulin; beta Ib tubulin; Beta1 tubulin; Class I beta tubulin; M40; MGC117247; MGC16435; OK/SW cl.56; OK/SWcl.56; TBB5_HUMAN; TUBB; TUBB 1; TUBB 2; TUBB 5; TUBB1; TUBB2; TUBB5; tubulin beta 1 chain; Tubulin beta 2 chain; tubulin beta 5 chain; Tubulin beta chain; Tubulin beta class I; tubulin beta polypeptide; Tubulin beta-5 chain
Protein Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Tissue Specificity
Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
Involvement in Disease
Cortical dysplasia, complex, with other brain malformations 6Skin creases, congenital symmetric circumferential, 1.
Shipping & Handling
Constituents
0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA.
Shipping
Shipped on dry ice.
