Product Overview
Description
CLPP-00150312 is recombinant human TUBB4A protein, His tag
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
Sequence Similarities
Belongs to the tubulin family.
Predicted Molecular Weight
54 kDa including tags
Target Information
Alternative Names
Beta 4; Beta 4 tubulin; beta 5; beta four tubulin; Dystonia 4 torsion (autosomal dominant); MC1R; TBB4_HUMAN; TUB B4; TUBB 4; tubb4; TUBB4A; TUBB5; Tubulin 5 beta; Tubulin beta 3; Tubulin beta 4; Tubulin beta 4 chain; Tubulin beta 4A class IVa; Tubulin beta 5; Tubulin beta IV; Tubulin beta-4 chain
Protein Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Involvement in Disease
Dystonia 4, torsion, autosomal dominant (DYT4): A form of torsion dystonia, a disease defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. 'Torsion' refers to the twisting nature of body movements, often affecting the trunk. DYT4 is characterized by onset in the second to third decade of progressive laryngeal dysphonia followed by the involvement of other muscles, such as the neck or limbs. Some patients develop an ataxic gait. The disease is caused by variants affecting the gene represented in this entry. Leukodystrophy, hypomyelinating, 6 (HLD): A neurologic disorder characterized by onset in infancy or early childhood of delayed motor development and gait instability, followed by extrapyramidal movement disorders, such as dystonia, choreoathetosis, rigidity, opisthotonus, and oculogyric crises, progressive spastic tetraplegia, ataxia, and, more rarely, seizures. Most patients have cognitive decline and speech delay, but some can function normally. Brain MRI shows a combination of hypomyelination, cerebellar atrophy, and atrophy or disappearance of the putamen. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
Tris buffer, 50% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
