Product Overview
Description
CLPP-00150302 is recombinant human BCCIP protein, BSA and azide free
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSEFMASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYS
LSDNDYDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQCVEQIQELVLRFCEK
NCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAA
LMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV
Sequence Similarities
Belongs to the BCP1 family.
Predicted Molecular Weight
39 kDa including tags
Target Information
Alternative Names
bccip; BCCIP_HUMAN; BCCIPalpha; BCCIPbeta; BRCA2 and CDKN1A interacting protein; BRCA2 and CDKN1A-interacting protein; BRCA2 and Cip1/p21 interacting protein; Cdk inhibitor p21 binding protein; P21 and CDK associated protein 1; P21- and CDK-associated protein 1; Protein TOK-1; Protein TOK1; TOK 1; TOK 1alpha; TOK 1beta; TOK1
Protein Function
During interphase, required for microtubule organizing and anchoring activities. During mitosis, required for the organization and stabilization of the spindle pole. Isoform 2/alpha is particularly important for the regulation of microtubule anchoring, microtubule stability, spindle architecture and spindle orientation, compared to isoform 1/beta. May promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A. May be required for repair of DNA damage by homologous recombination in conjunction with BRCA2. May not be involved in non-homologous end joining (NHEJ).
Tissue Specificity
Expressed at high levels in testis and skeletal muscle and at lower levels in brain, heart, kidney, liver, lung, ovary, pancreas, placenta, and spleen.
Shipping & Handling
Constituents
0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol (glycerin, glycerine), 0.02% DTT.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
