Product Overview
Description
CLPP-00150296 is recombinant human VTCN1 protein
Applications
Functional Studies, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Endotoxin Level
< 1.000 Eu/µg
Sequence
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Sequence Similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family. Contains 2 Ig-like V-type (immunoglobulin-like) domains.
Predicted Molecular Weight
26 kDa including tags
Target Information
Alternative Names
B7 family member, H4; B7 H4; B7 homolog 4; B7 superfamily member 1; B7 superfamily, member 1; B7-H4; B7h.5; B7h4; B7S1; B7x; BC032925; Immune costimulatory protein B7-H4; Immune costimulatory protein B7H4; MGC41287; PRO1291; Protein B7S1; RP11 229A19.4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V set domain-containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; VCTN1; Vtcn1; VTCN1_HUMAN
Protein Function
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
Tissue Specificity
Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
Shipping & Handling
Constituents
5% Trehalose, 95% PBS.
Shipping
Shipped at 4 °C.
