Recombinant Human Aurora A Protein

Cat. No.: CLPP-00150286

Product Size: 50 µg Custom size

Product Overview

Description
CLPP-00150286 is recombinant human AURKA protein
Purity
> 95%
Applications
SDS-PAGE
Protein Length
Full length protein
Animal Free
No
Nature
Recombinant Protein
Species
Human
Form
Liquid
Sequence
MGSSHHHHHHSSGLVPRGSHMDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKR
ISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
Sequence Similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily. Contains 1 protein kinase domain.

Target Information

Protein Name
AURKA
UniProt No.
Alternative Names
AIK; ARK-1; ARK1; AURA; Aurka; Aurora 2; Aurora A; Aurora kinase A; Aurora-related kinase 1; Aurora/IPL1 like kinase; AURORA/IPL1-like kinase; Aurora/IPL1-related kinase 1; AURORA2; Breast tumor-amplified kinase; BTAK; hARK1; IAK; IPL1 related kinase; MGC34538; OTTHUMP00000031340; OTTHUMP00000031341; OTTHUMP00000031342; OTTHUMP00000031343; OTTHUMP00000031344; OTTHUMP00000031345; OTTHUMP00000166071; OTTHUMP00000166072; PPP1R47; Protein phosphatase 1, regulatory subunit 47; Serine/threonine kinase 15; Serine/threonine kinase 6; Serine/threonine protein kinase 15; Serine/threonine-protein kinase 15; Serine/threonine-protein kinase 6; Serine/threonine-protein kinase aurora-A; STK15; STK6; STK6_HUMAN; STK7
Protein Function
Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase. Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Important for microtubule formation and/or stabilization. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and destabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Inhibits cilia outgrowth (By similarity). Required for cilia disassembly via phosphorylation of HDAC6 and subsequent deacetylation of alpha-tubulin. Regulates protein levels of the anti-apoptosis protein BIRC5 by suppressing the expression of the SCF(FBXL7) E3 ubiquitin-protein ligase substrate adapter FBXL7 through the phosphorylation of the transcription factor FOXP1.
Tissue Specificity
Highly expressed in testis and weakly in skeletal muscle, thymus and spleen. Also highly expressed in colon, ovarian, prostate, neuroblastoma, breast and cervical cancer cell lines.

Shipping & Handling

pH
pH: 8.0
Constituents
0.0038% EGTA, 0.0077% DTT, 0.316% Tris HCl, 0.00292% EDTA, 0.58% Sodium chloride.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry