Product Overview
Description
CLPP-00150280 is recombinant human CYP19A1 protein
Applications
ELISA, SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDGTEIFTLTS
Sequence Similarities
Belongs to the cytochrome P450 family.
Predicted Molecular Weight
50 kDa including tags
Target Information
Alternative Names
ARO; ARO1; Aromatase; CP19A_HUMAN; CPV1; CYAR; CYP19; Cyp19a1; CYPXIX; Cytochrome P-450AROM; Cytochrome P450 19A1; Cytochrome P450, family 19, subfamily A, polypeptide 1; Cytochrome P450, subfamily XIX (aromatization of androgens); Estrogen synthase; Estrogen synthetase; Flavoprotein linked monooxygenase; MGC104309; Microsomal monooxygenase; OTTHUMP00000162543; OTTHUMP00000198350; P 450AROM
Protein Function
A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively. Catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid. Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Converts dihydrotestosterone to delta1,10-dehydro 19-nordihydrotestosterone and may play a role in homeostasis of this potent androgen. Also displays 2-hydroxylase activity toward estrone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Tissue Specificity
Brain, placenta and gonads.
Involvement in Disease
Defects in CYP19A1 are a cause of aromatase excess syndrome (AEXS); also known as familial gynecomastia. AEXS is characterized by an estrogen excess due to an increased aromatase activity.Defects in CYP19A1 are the cause of aromatase deficiency (AROD). AROD is a rare disease in which fetal androgens are not converted into estrogens due to placental aromatase deficiency. Thus, pregnant women exhibit a hirsutism, which spontaneously resolves after post-partum. At birth, female babies present with pseudohermaphroditism due to virilization of extern genital organs. In adult females, manifestations include delay of puberty, breast hypoplasia and primary amenorrhoea with multicystic ovaries.
Shipping & Handling
Constituents
0.3% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
