Product Overview
Description
CLPP-00150279 is recombinant human ARL4C protein
Applications
ELISA, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
Sequence Similarities
Belongs to the small GTPase superfamily. Arf family.
Target Information
Alternative Names
ADP ribosylation factor like 4C; ADP ribosylation factor like 7; ADP-ribosylation factor-like protein 4C; ADP-ribosylation factor-like protein 7; ADP-ribosylation factor-like protein LAK; Arl4c; ARL4C_HUMAN; ARL7; LAK
Protein Function
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. May be involved in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in the GDP-bound form. Regulates the microtubule-dependent intracellular vesicular transport from early endosome to recycling endosome process.
Tissue Specificity
Expressed in several tumor cell lines (at protein level). Expressed in lung, brain, leukocytes and placenta.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
