Product Overview
Description
CLPP-00150276 is recombinant human ANG protein, denatured
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENL
RISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP
Sequence Similarities
Belongs to the pancreatic ribonuclease family.
Predicted Molecular Weight
16 kDa including tags
Target Information
Alternative Names
ALS9; AMYOTROPHIC LATERAL SCLEROSIS; ANG; ANG 1; ANG I; ANG1; ANGI; ANGI_HUMAN; Angiogenin; Angiogenin ribonuclease RNase A family, 5; Epididymis luminal protein 168; HEL168; MGC22466; MGC71966; Ribonuclease 5; Ribonuclease RNase A Family 5; RNase 5; RNASE4; RNASE5
Protein Function
May function as a tRNA-specific ribonuclease that abolishes protein synthesis by specifically hydrolyzing cellular tRNAs. Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
Tissue Specificity
Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons.
Involvement in Disease
Defects in ANG are the cause of susceptibility to amyotrophic lateral sclerosis type 9 (ALS9). ALS is a degenerative disorder of motor neurons in the cortex, brain stem and spinal cord. ALS is characterized by muscular weakness and atrophy.
Shipping & Handling
Constituents
0.32% Tris HCl, 2.4% Urea, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
