Product Overview
Description
AKAP9 - A kinase (PRKA) anchor protein (yotiao) 9
Applications
Western Blot, ELISA, Protein Array
Nature
Partial Recombinant Protein
Sequence
EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
Predicted Molecular Weight
36.74 kDa
Target Information
Alternative Names
A kinase (PRKA) anchor protein (yotiao) 9; AKAP 350; AKAP 450; AKAP350A-kinase anchor protein 450 kDa; AKAP450A-kinase anchor protein 350 kDa; AKAP-9; Centrosome- and Golgi-localized PKN-associated protein; CG-NAPAKAP 120-like protein; hgAKAP 350; HYPERION; KIAA0803A-kinase anchor protein 9; MU-RMS-40.16A; PRKA9AKAP9-BRAF fusion protein; Protein hyperion; protein kinase A anchoring protein 9; Protein kinase A-anchoring protein 9; Protein yotiao; YOTIAOkinase N-associated protein
Protein Function
Scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. Required to maintain the integrity of the Golgi apparatus. Required for microtubule nucleation at the cis-side of the Golgi apparatus. Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. In complex with PDE4DIP isoform 13/MMG8/SMYLE, recruits CAMSAP2 to the Golgi apparatus and tethers non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. In complex with PDE4DIP isoform 13/MMG8/SMYLE, EB1/MAPRE1 and CDK5RAP2, contributes to microtubules nucleation and extension also from the centrosome to the cell periphery; Associated with the N-methyl-D-aspartate receptor and is specifically found in the neuromuscular junction (NMJ) as well as in neuronal synapses, suggesting a role in the organization of postsynaptic specializations.
Involvement in Disease
Long QT syndrome 11 (LQT11): A heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Shipping
Shipped on dry ice.
