Product Overview
Description
CLPP-00150268 is recombinant human ACTN1 protein
Applications
Mass Spectrometry, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
MGSSHHHHHHSSGLVPRGSHMGSEFMDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAF
Sequence Similarities
Belongs to the alpha-actinin family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 2 EF-hand domains. Contains 4 spectrin repeats.
Predicted Molecular Weight
31 kDa including tags
Target Information
Alternative Names
Actinin 1 smooth muscle; Actinin alpha 1; actinin, alpha 1; ACTN 1; Actn1; ACTN1_HUMAN; Alpha Actinin 1; Alpha actinin cytoskeletal isoform; Alpha-actinin cytoskeletal isoform; Alpha-actinin-1; BDPLT15; F actin cross linking protein; F-actin cross-linking protein; FLJ40884; FLJ54432; Non muscle alpha actinin 1; Non-muscle alpha-actinin-1
Protein Function
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Involvement in Disease
Bleeding disorder, platelet-type, 15 (BDPLT15): An autosomal dominant form of macrothrombocytopenia. Affected individuals usually have no or only mild bleeding tendency, such as epistaxis. Laboratory studies show decreased numbers of large platelets and anisocytosis, but the platelets show no in vitro functional abnormalities. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
89% PBS, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
