Product Overview
Description
CLPP-00150229 is recombinant human ACVR1B protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Sequence Similarities
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain.
Target Information
Alternative Names
Activin A receptor type 1B; Activin A receptor type II like kinase 4; Activin A type 1B receptor; Activin A type IB receptor; Activin receptor like kinase 4; Activin receptor type 1B; Activin receptor type IB; Activin receptor type-1B; Activin receptor-like kinase 4; ACTR IB; ACTR-IB; ACTRIB; ACV1B_HUMAN; ACVR 1B; Acvr1b; ACVRLK 4; ACVRLK4; ALK 4; ALK-4; ALK4; Serine(threonine) protein kinase receptor R2; Serine/threonine-protein kinase receptor R2; SKR 2; SKR2
Protein Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Phosphorylates TDP2.
Tissue Specificity
Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.
Involvement in Disease
ACVRIB is abundantly expressed in systemic sclerosis patient fibroblasts and production of collagen is also induced by activin-A/INHBA. This suggests that the activin/ACRV1B signaling mechanism is involved in systemic sclerosis.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
