Product Overview
Description
CLPP-00150223 is recombinant human ACP1 protein
Applications
Functional Studies, SDS-PAGE
Protein Length
Full length protein
Nature
Recombinant Protein
Endotoxin Level
< 0.100 Eu/µg
Sequence
MGSSHHHHHHSSGLVPRGSHMAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Sequence Similarities
Belongs to the low molecular weight phosphotyrosine protein phosphatase family.
Predicted Molecular Weight
20 kDa including tags
Target Information
Alternative Names
Acid phosphatase 1 soluble; Acid phosphatase of erythrocyte; ACP1; Adipocyte acid phosphatase; Cytoplasmic phosphotyrosyl protein phosphatase; HAAP; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; Low molecular weight phosphotyrosine protein phosphatase; PAP1; PAP2; phosphatase, acid, of erythrocyte; PPAC_HUMAN; Protein tyrosine phosphatase; PTPase; Purple acid phosphatase; Red cell acid phosphatase 1; testicular secretory protein Li 37
Protein Function
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates with differences in substrate specificity between isoform 1 and isoform 2; Does not possess phosphatase activity.
Tissue Specificity
T-lymphocytes express only isoform 2.
Shipping & Handling
Constituents
0.39% MES, 0.002% PMSF, 0.06% EDTA, 10% Glycerol (glycerin, glycerine).
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
