Product Overview
Description
CLPP-00150221 is recombinant human ABI1 protein
Applications
ELISA, Western Blot
Protein Length
Protein fragment
Nature
Recombinant Protein
Sequence
GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
Sequence Similarities
Belongs to the ABI family. Contains 1 SH3 domain. Contains 1 t-SNARE coiled-coil homology domain.
Target Information
Alternative Names
Abelson interactor 1; Abi-1; Abi1; ABI1_HUMAN; Abl binding protein 4; Abl interactor 1; Abl interactor protein 1; Abl-binding protein 4; AblBP4; e3B1; Eps8 binding protein; Eps8 SH3 domain binding protein; Eps8 SH3 domain-binding protein; Eps8-binding protein; Hssh3bp1; Interactor protein AblBP4; NAP1; Nap1 binding protein; Nap1-binding protein; Nap1BP; Spectrin SH3 domain binding protein 1; Spectrin SH3 domain-binding protein 1; SSH3BP
Protein Function
May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level. In brain, seems to regulate the dendritic outgrowth and branching as well as to determine the shape and number of synaptic contacts of developing neurons.
Tissue Specificity
Widely expressed, with highest expression in brain.
Involvement in Disease
A chromosomal aberration involving ABI1 is a cause of acute leukemias. Translocation t(10;11)(p11.2;q23) with MLL. ABI1 isoform 2 was found to be present in acute leukemia MLL-ABI1 fusion transcript.
Shipping & Handling
Constituents
0.31% Glutathione, 0.79% Tris HCl.
Shipping
Shipped on dry ice.
