Product Overview
Description
CLPP-00150220 is recombinant human YWHAZ protein
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Sequence Similarities
Belongs to the 14-3-3 family.
Predicted Molecular Weight
32 kDa
Target Information
Alternative Names
14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide; Tyrosine 3/tryptophan 5monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ
Protein Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Promotes cytosolic retention and inactivation of TFEB transcription factor by binding to phosphorylated TFEB. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity (By similarity).
Shipping & Handling
Shipping
Shipped at 4 °C.
