Product Overview
Description
CLPP-00150219 is recombinant human YWHAB protein
Applications
SDS-PAGE, Western Blot
Protein Length
Full length protein
Nature
Recombinant Protein
Sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Sequence Similarities
Belongs to the 14-3-3 family.
Target Information
Alternative Names
14 3 3 alpha; 14 3 3 protein beta/alpha; 14-3-3 protein beta/alpha; 1433B_HUMAN; Brain protein 14 3 3 beta isoform; GW128; HS 1; KCIP-1; KCIP1; N-terminally processed; Protein 1054; Protein kinase C inhibitor protein 1; YWHAA; YWHAB
Protein Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
Shipping & Handling
Constituents
0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 25% Glycerol (glycerin, glycerine), 0.29% Sodium chloride.
Shipping
Shipped on dry ice.
