Product Overview
Description
CLPP-00150212 is recombinant Cynomolgus monkey CSF1R protein, His tag
Applications
ELISA, SDS-PAGE
Protein Length
Protein fragment
Nature
Recombinant Protein
Species
Cynomolgus monkey
Endotoxin Level
< 1.000 Eu/µg
Sequence
IPVIEPSGPELVVKPGETVTLRCVGNGSVEWDGPISPHWTLYSDGPSSVLTT
NNATFQNTRTYRCTEPGDPLRGSAAIHLYVKDPARPWNVLAKEVVVFEDQ
DALLPCLLTDPVLEAGVSLVRLRGRPLLRHTNYSFSPWHGFIIHRAKFIQ
GQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPEELVRIRGEAAQ
IVCSASNIDVDFDVFLQHNTTKLAIPQRSDFHDNRYQKVLTLSLGQVDFQ
HAGNYSCVASNVQGKHSTSMFFRVVESAYLDLSSEQNLIQEVTVGEGLNL
KVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRL
KPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTSINGSGTLLCAA
SGYPQPNVTWLQCAGHTDRCDEAQVLQVWVDPHPEVLSQEPFQKVTVQSL
LTTETLEHNQTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTP
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily. Contains 5 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain.
Predicted Molecular Weight
57 kDa including tags
Target Information
Alternative Names
C FMS; CD 115; CD115; CD115 antigen; CFMS; Colony stimulating factor 1 receptor; Colony stimulating factor I receptor; CSF 1 R; CSF 1R; CSF-1 receptor; CSF-1-R; CSF1 R; CSF1R; CSF1R_HUMAN; CSFR; EC 2.7.10.1; FIM 2; FIM2; FMS; FMS proto oncogene; FMS protooncogene; HDLS; M-CSF Receptor; M-CSF-R; Macrophage colony stimulating factor 1 receptor; Macrophage colony stimulating factor I receptor; Macrophage colony-stimulating factor 1 receptor; McDonough feline sarcoma viral (v fms) oncogene homolog; MCSFR; Oncogen FMS; Proto-oncogene c-Fms; V-FMS McDonough feline sarcoma viral oncogen homolog, formerly
Protein Function
Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages.
Tissue Specificity
Expressed in bone marrow and in differentiated blood mononuclear cells.
Involvement in Disease
Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers. Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. Leukoencephalopathy, hereditary diffuse, with spheroids 1 (HDLS1); Brain abnormalities, neurodegeneration, and dysosteosclerosis (BANDDOS).
Shipping & Handling
Constituents
The trehalose is mostly about 3-5%.
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
