Product Overview
Description
CEP97 (centrosomal protein of 97 kDa) has been identified as part of a complex with CP110.Together, CP110 and CEP97 have been shown to play a role in the assembly of cilia.Loss of CEP97 or CEP110 promotes cilia formation while forced expression inhibits ciliogenesis. CEP97 is also known as leucine-rich repeat and IQ domain-containing protein 2 or LRRIQ2.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN
Predicted Molecular Weight
33 kDa
Target Information
Alternative Names
2810403B08Rik; centrosomal protein 97kDa; centrosomal protein of 97 kDa; Cep97; FLJ23047; FLJ26462; Leucine-rich repeat and IQ domain-containing protein 2; leucine-rich repeats and IQ motif containing 2; LRRIQ2
Protein Function
Acts as a key negative regulator of ciliogenesis in collaboration with CCP110 by capping the mother centriole thereby preventing cilia formation. Required for recruitment of CCP110 to the centrosome.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
