Product Overview
Description
The CEP63 gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneousorganelle that functions as the major microtubule-organizing center in animal cells.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
Predicted Molecular Weight
28 kDa
Target Information
Alternative Names
Centrosomal protein 63kDa; Centrosomal protein of 63 kDa; centrosome protein CEP63; Cep63; FLJ13386; MGC78416
Protein Function
Required for normal spindle assembly. Plays a key role in mother-centriole-dependent centriole duplication; the function seems also to involve CEP152, CDK5RAP2 and WDR62 through a stepwise assembled complex at the centrosome that recruits CDK2 required for centriole duplication. Reported to be required for centrosomal recruitment of CEP152; however, this function has been questioned. Also recruits CDK1 to centrosomes. Plays a role in DNA damage response. Following DNA damage, such as double-strand breaks (DSBs), is removed from centrosomes; this leads to the inactivation of spindle assembly and delay in mitotic progression.
Involvement in Disease
Seckel syndrome 6 (SCKL6): A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and intellectual disability. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
