Recombinant CEP57 Protein

Cat. No.: CLPP-00150041

Product Size: 100 µg Custom size

Product Overview

Description
Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity.
Purity
> 80%
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
Predicted Molecular Weight
31 kDa

Target Information

Protein Name
CEP57
UniProt No.
Alternative Names
Centrosomal protein 57kDa; Cep57; FGF2-interacting protein; KIAA0092Centrosomal protein of 57 kDa; PIG8; Testis-specific protein 57; Translokin; TSP57proliferation-inducing protein 8
Protein Function
Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but that of FGF1.
Involvement in Disease
Mosaic variegated aneuploidy syndrome 2 (MVA2): A severe developmental disorder characterized by mosaic aneuploidies, predominantly trisomies and monosomies, involving multiple different chromosomes and tissues. Affected individuals typically present with severe intrauterine growth retardation and microcephaly. Eye anomalies, mild dysmorphism, variable developmental delay, and a broad spectrum of additional congenital abnormalities and medical conditions may also occur. The risk of malignancy is high, with rhabdomyosarcoma, Wilms tumor and leukemia reported in several cases. The disease is caused by variants affecting the gene represented in this entry.

Shipping & Handling

Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
Storage
Store at -20 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry