Product Overview
Description
CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation. Recruits PDCD6IP and TSG101 to midbody during cytokinesis
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
Predicted Molecular Weight
24 kDa
Target Information
Alternative Names
C10orf3; cancer/testis antigen 111; centrosomal protein 55kDa; centrosomal protein of 55 kDa; Cep55; chromosome 10 open reading frame 3; CT111; FLJ10540; Up-regulated in colon cancer 6; URCC6
Protein Function
Plays a role in mitotic exit and cytokinesis. Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis. Not required for microtubule nucleation. Plays a role in the development of the brain and kidney.
Involvement in Disease
Multinucleated neurons, anhydramnios, renal dysplasia, cerebellar hypoplasia and hydranencephaly (MARCH): An autosomal recessive, congenital disease characterized by severe hydranencephaly with multinucleated neurons, renal aplasia or dysplasia, and hypoplastic kidneys. Hydranencephaly is an anomaly leading to replacement of the cerebral hemispheres with a fluid-filled cyst. MARCH results in death in utero or in the perinatal period. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
