Product Overview
Description
CAP350 (Centrosome-Associated protein 350) has been shown to localize to the centrosome as well as to dots in the pericentrosomal area. CAP350 functions to stabilize and anchor microtubules to the centrosome and participates in the maintenance of a pericentrosomal Golgi ribbon.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
Predicted Molecular Weight
28 kDa
Target Information
Alternative Names
CAP350GM133; centrosomal protein 350kDa; centrosome-associated protein 350; Centrosome-associated protein of 350 kDa; Cep350; FLJ38282; FLJ44058; KIAA0480centrosome associated protein 350
Protein Function
Plays an essential role in centriole growth by stabilizing a procentriolar seed composed of at least, SASS6 and CENPJ. Required for anchoring microtubules to the centrosomes and for the integrity of the microtubule network. Recruits PPARA to discrete subcellular compartments and thereby modulates PPARA activity. Required for ciliation.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
