Product Overview
Description
The product of this gene is a component of the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. During interphase, the encoded protein localizes to the sub-distal appendages of mature centrioles, which are microtubule-based structures thought to help organize centrosomes. During mitosis, the protein associates with spindle microtubules near the centrosomes. The protein interacts with and is phosphorylated by polo-like kinase 1, and functions in maintaining microtubule organization and cell morphology. The human genome contains a putative transcribed pseudogene. Several alternatively spliced transcript variants of this gene have been found, but the full-length nature of some of these variants has not been determined.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
IPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKT
Predicted Molecular Weight
29 kDa
Target Information
Alternative Names
Centrosomal protein 170kDa; Cep170; KARP 1 binding protein; KARP-1-binding protein; KARP1-binding protein; KIAA0470FAM68AKABCentrosomal protein of 170 kDa; XRCC5 binding protein
Protein Function
Plays a role in microtubule organization. Required for centriole subdistal appendage assembly.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
