Product Overview
Description
CDK5RAP2 is a potential regulator of CDK5 activity via its interaction with CDK5R1.This novel protein is widely expressed in human tissues, including the heart, brain, skeletal muscle, placenta, lung, liver, kidney and pancreas.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD
Predicted Molecular Weight
28 kDa
Target Information
Alternative Names
C48; CDK5 activator-binding protein C48; CDK5 regulatory subunit associated protein 2; CDK5 regulatory subunit-associated protein 2; centrosomal protein 215 kDa; Centrosome-associated protein 215; Cep215; DKFZp686B1070; DKFZp686D1070; FLJ10867; KIAA1633microcephaly, primary autosomal recessive 3; MCPH3
Protein Function
Potential regulator of CDK5 activity via its interaction with CDK5R1. Negative regulator of centriole disengagement (licensing) which maintains centriole engagement and cohesion. Involved in regulation of mitotic spindle orientation (By similarity). Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Together with EB1/MAPRE1, may promote microtubule polymerization, bundle formation, growth and dynamics at the plus ends. Regulates centrosomal maturation by recruitment of the gamma-tubulin ring complex (gamma-TuRC) onto centrosomes. In complex with PDE4DIP isoform 13/MMG8/SMYLE, MAPRE1 and AKAP9, contributes to microtubules nucleation and extension from the centrosome to the cell periphery. Required for the recruitment of AKAP9 to centrosomes. Plays a role in neurogenesis (By similarity).
Involvement in Disease
Microcephaly 3, primary, autosomal recessive (MCPH3): A disease defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Affected individuals are mentally retarded. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits due to degenerative brain disorder. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.