Product Overview
Description
CEP131/AZ1 was originally identified as a transcript that was increased in cells exposed to the demethylating agent, azacytidine. It was found to localize to the pre-acrosome region of spermatids and therefore thought to play a role in spermatogenesis. CEP131/AZ1 has also been identified as a component of the centrosome.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Predicted Molecular Weight
27 kDa
Target Information
Alternative Names
5-azacytidine induced 1; 5-azacytidine-induced protein 1; AZ1; centrosomal protein 131 kDa; centrosomal protein of 131 kDa; CEP131; KIAA1118; pre-acrosome localization protein 1; ZA1
Protein Function
Component of centriolar satellites contributing to the building of a complex and dynamic network required to regulate cilia/flagellum formation. In proliferating cells, MIB1-mediated ubiquitination induces its sequestration within centriolar satellites, precluding untimely cilia formation initiation. In contrast, during normal and ultraviolet or heat shock cellular stress-induced ciliogenesis, its non-ubiquitinated form is rapidly displaced from centriolar satellites and recruited to centrosome/basal bodies in a microtubule- and p38 MAPK-dependent manner. Acts also as a negative regulator of BBSome ciliary trafficking. Plays a role in sperm flagellar formation; may be involved in the regulation of intraflagellar transport (IFT) and/or intramanchette (IMT) trafficking, which are important for axoneme extension and/or cargo delivery to the nascent sperm tail (By similarity). Required for optimal cell proliferation and cell cycle progression; may play a role in the regulation of genome stability in non-ciliogenic cells. Involved in centriole duplication (By similarity). Required for CEP152, WDR62 and CEP63 centrosomal localization and promotes the centrosomal localization of CDK2. Essential for maintaining proper centriolar satellite integrity.
Shipping & Handling
Shipping
Shipped on dry ice.
Constituents
PBS and 1M Urea, pH 7.4.
