RANBP9 Recombinant Protein

Cat. No.: CLPP-00150205

Product Size: 100 µg Custom size

Product Overview

Description
Just as heat shock proteins function as chaperones for exposed hydrophobic patches, importins act as chaperones for exposed basic domains, and it is suggested that this represents a major and general cellular function of importins. RanBP9, a novel interacting protein, was localized within the centrosome throughout the cell cycle. Overexpression of RanBP9 produced multiple spots which were colocalized with gamma-tubulin and acted as ectopic microtubule nucleation sites, resulting in a reorganization of microtubule network. It has been shown that RanBP9 can induce GTP-Ras association and Erk phosphorylation and elevate serum response element-luciferase (SRE-LUC) expression, indicating that RanBP9 can activate the Ras-Erk-SRE pathway. Also RanBP9 stimulates Ras activation by recruiting Sos.
Purity
> 80%
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
YPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVP
Predicted Molecular Weight
25 kDa

Target Information

Protein Name
RANBP9
Alternative Names
BPM90; BPM-L; RAN binding protein 9; Ran Binding Protein in the Microtubule organizing center; ran binding protein, centrosomal; ran-binding protein 9; Ran-binding protein M; RanBP7; RanBP9; RanBPM; RANBPMnovel centrosomal protein RanBPM
Protein Function
Nuclear transport receptor that mediates nuclear import of proteins, such as histones, proteasome and actin. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the import of pre-assembled proteasomes into the nucleus; AKIRIN2 acts as a molecular bridge between IPO9 and the proteasome complex. Mediates the nuclear import of histones H2A, H2B, H4 and H4. In addition to nuclear import, also acts as a chaperone for histones by preventing inappropriate non-nucleosomal interactions. Mediates the nuclear import of actin (By similarity).

Shipping & Handling

Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
Storage
Store at -20 °C.

For Research Use Only. Not For Clinical Use.

Online Inquiry