Product Overview
Description
Ninein encodes one of the proteins important for centrosomal function. This protein is important for positioning and anchoring the microtubules minus-ends in epithelial cells. Localization of this protein to the centrosome requires three leucine zippers in the central coiled coil domain. Multiple alternatively spliced transcript variants that encode different isoforms have been reported.
Applications
Antibody Competition
Nature
Recombinant Protein
Sequence
EPGLVMSSCLDEPATEFFGNTAEQTEQFLQQNRTKQVEGVTRRHVLSDLEDDEVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETRTESWELKN
Predicted Molecular Weight
29 kDa
Target Information
Alternative Names
Glycogen synthase kinase 3 beta-interacting protein; GSK3B-interacting protein; hNinein; KIAA1565; ninein (GSK3B interacting protein); ninein centrosomal protein; ninein
Protein Function
Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells. May also act as a centrosome maturation factor. May play a role in microtubule nucleation, by recruiting the gamma-tubulin ring complex to the centrosome. Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules. Required for centriole organization and microtubule anchoring at the mother centriole.
Involvement in Disease
Seckel syndrome 7 (SCKL7): A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and intellectual disability. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Constituents
PBS and 1M Urea, pH 7.4.
Shipping
Shipped on dry ice.
