Product Overview
Description
CLPP-00150193 is Native cow S100B protein
Protein Length
Full length protein
Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETL
DSDGDGECDFQEFMAFVAMITTACHEFFEHE
Sequence Similarities
Belongs to the S-101 family. Contains 2 EF-hand domains.
Predicted Molecular Weight
6 kDa
Target Information
Alternative Names
NEF; Protein S100 B; Protein S100-B; S 100 calcium binding protein beta chain; S 100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 protein beta chain; S100B; S100B_HUMAN; S100beta
Protein Function
Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Tissue Specificity
Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
Shipping & Handling
Constituents
0.79% Tris HCl, 0.29% Sodium chloride, 0.001% DTT.
Shipping
Shipped at 4 °C.