Product Overview
Description
CLPP-00150093 is synthetic human CDKN2A Peptide
Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Target Information
Alternative Names
CCM2; CDK4 inhibitor p16 INK4; CDK4I; CDKN2; CDKN2A; Cell cycle negative regulator beta; CMM2; Cyclin dependent kinase 4 inhibitor A; Cyclin Dependent Kinase Inhibitor 2A; Cyclin dependent kinase inhibitor 2A (melanoma p16 inhibits CDK4); Cyclin dependent kinase inhibitor 2A isoform 4; Cyclin dependent kinase inhibitor 2A isoforms 1/2/3; Cyclin dependent kinase inhibitor p16; INK4; INK4A; MLM; MTS1; Multiple tumor suppressor 1; p14; p16; P16INK4; p16INK4a; p19; p19Arf; TP16
Protein Function
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
Involvement in Disease
The association between cutaneous and uveal melanomas in some families suggests that mutations in CDKN2A may account for a proportion of uveal melanomas. However, CDKN2A mutations are rarely found in uveal melanoma patients. Melanoma, cutaneous malignant 2 (CMM2): A malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but may also involve other sites. Disease susceptibility is associated with variants affecting the gene represented in this entry. Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome (FAMMMPC): An inherited cancer predisposition syndrome characterized by an increased risk of developing malignant melanoma and/or pancreatic cancer. Mutation carriers within families may develop either or both types of cancer. The disease is caused by variants affecting the gene represented in this entry. Melanoma-astrocytoma syndrome (MASTS): Characterized by a dual predisposition to melanoma and neural system tumors, commonly astrocytoma. The disease is caused by variants affecting the gene represented in this entry.
Shipping & Handling
Shipping
Shipped at 4 °C.
Storage
Store at -20 °C or -80 °C.
