Product Overview
Description
BLOC1S2 protein is an over-expression Lysate BLOC1S2 with Myc-DDK (Flag) tag(s).
Endotoxin Level
Not Tested
Sequence
MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Predicted Molecular Weight
11.3 kDa
Target Information
Alternative Names
BLOC1S2; Centrosome protein oncogene; Centrosome-associated protein; CEAP; RP11-316M21.4; BLOC-1 subunit 2; BLOS2; Centrosomal 10 kDa protein
Protein Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (By similarity). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. May play a role in cell proliferation.
Shipping & Handling
Constituents
25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
Shipping
Shipped on dry ice.
Storage
Stored in -20 °C for long term storage.
